| Sku |
AAP61473 |
| Old sku |
AAPP47613 |
| Price |
$99.00 |
| Name |
GCK Peptide - N-terminal region (AAP61473) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
GCK |
| Alias symbols |
FGQTL3, GK, GLK, HHF3, HK4, HKIV, HXKP, MODY2, LGLK |
| Gene id |
2645 |
| Description of target |
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. Alternative splicing of this gene results in three tissue-specific forms of glucokinase, one found in pancreatic islet beta cells and two found in liver. The protein localizes to the outer membrane of mitochondria. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. Mutations in this gene have been associated with non-insulin dependent diabetes mellitus (NIDDM), maturity onset diabetes of the young, type 2 (MODY2) and persistent hyperinsulinemic hypoglycemia of infancy (PHHI). |
| Swissprot id |
P35557-3 |
| Protein accession num |
NP_277043 |
| Nucleotide accession num |
NM_033508 |
| Protein size |
464 amino acids |
| Molecular weight |
51kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL |
| Partner proteins |
GCKR,INS,PFKFB2,GCKR,MIG1,PFKFB2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-GCK Antibody (ARP61473_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
