| Sku |
AAP61142 |
| Old sku |
AAPP47252 |
| Price |
$99.00 |
| Name |
CLU Peptide - C-terminal region (AAP61142) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CLU |
| Alias symbols |
AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, TRPM-2, TRPM2, APO-J, NA1/NA2 |
| Gene id |
1191 |
| Description of target |
The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants. |
| Swissprot id |
P10909 |
| Protein accession num |
NP_001822 |
| Nucleotide accession num |
NM_001831 |
| Protein size |
501 amino acids |
| Molecular weight |
58kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN |
| Partner proteins |
CLU,CLUAP1,TGFBR1,TGFBR2,XRCC6,APP,C7,C8B,C9,CLUAP1,LEP,LEPR,LRP2,LRP8,MMP25,PON1,PRNP,TGFBR1,TGFBR2,VLDLR,XRCC6,C7,C8B,C9,CLU,LEP,LRP2,MMP25,TGFBR1,TGFBR2,VLDLR,XRCC6 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CLU Antibody (ARP61142_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
