Hprt Peptide - C-terminal region (AAP61048)

Data Sheet
 
Sku AAP61048
Price $99.00
Name Hprt Peptide - C-terminal region (AAP61048)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Hprt
Alias symbols C81579, HPGRT, Hprt1, MGC103149
Gene id 15452
Description of target Hprt converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Hprt transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Hprt plays a central role in the generation of purine nucleotides through the purine salvage pathway.
Swissprot id P00492
Protein accession num NP_038584
Nucleotide accession num NM_013556
Protein size 218 amino acids
Molecular weight 24kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Hprt Antibody (ARP61048_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com