EGFR Peptide - middle region (AAP61003)

Data Sheet
 
Sku AAP61003
Price $99.00
Name EGFR Peptide - middle region (AAP61003)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene EGFR
Alias symbols ERBB, ERBB1, HER1, PIG61, mENA
Gene id 1956
Description of target The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
Swissprot id P00533
Protein accession num NP_958439
Nucleotide accession num NM_201282
Protein size 628 amino acids
Molecular weight 69kDa
Species reactivity Human
Application WB
Peptide sequence VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
Partner proteins CALM1,CD44,CDH1,EGF,EGFR,ERBB2,GRB2,HSP90AA1,MUC1,PAK1,PIK3R1,PIK3R2,PLCG1,PLD2,RASA1,SHC1,SHC1,SHC1,STAT3,VAV2,ACTA1,ADRBK1,AGTR1,ALCAM,AMH,ANXA1,AR,AREG,ARF4,ATP1A1,ATP1B1,ATP5C1,BTC,CALM1,CALM3,CALM3,CAMK2A,CAMK2G,CAMLG,CASP1,CAV1,CAV2,CAV3,CBL,CBLB,CB
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-EGFR Antibody (ARP61003_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com