ENO2 Peptide - middle region (AAP60777)

Data Sheet
 
Sku AAP60777
Old sku AAPP46966
Price $99.00
Name ENO2 Peptide - middle region (AAP60777)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene symbol ENO2
Alias symbols NSE
Gene id 2026
Description of target This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Swissprot id P09104
Protein accession num NP_001966
Nucleotide accession num NM_001975
Protein size 434 amino acids
Molecular weight 47kDa
Species reactivity Human
Application WB
Peptide sequence ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE
Partner proteins ANXA11,C16orf45,C6orf47,ENSA,HABP4,HK1,HSF1,IL17B,MAP4,NAT9,NDUFS7,SIGIRR,SNUPN,ST3GAL2,SUMO4,TUBA4A,UBE2C,ANXA11,C16orf45,C6orf47,ENSA,HABP4,HK1,HSF1,IL17B,MAP4,NAT9,NDUFS7,SIGIRR,SNUPN,ST3GAL2,TUBA4A,UBE2C
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ENO2 Antibody (ARP60777_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com