MIA2 Peptide - C-terminal region (AAP60753)

Data Sheet
 
Sku AAP60753
Old sku AAPP46946
Price $99.00
Name MIA2 Peptide - C-terminal region (AAP60753)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MIA2
Alias symbols FLJ22404
Gene id 117153
Description of target MIA2 may play a role in the pathophysiology of liver disease and may serve as a marker of liver damage.
Swissprot id Q96PC5-2
Protein accession num NP_473365
Nucleotide accession num NM_054024
Protein size 654 amino acids
Molecular weight 74kDa
Species reactivity Human
Application WB
Peptide sequence NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MIA2 Antibody (ARP60753_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com