| Sku |
AAP60748 |
| Old sku |
AAPP46941 |
| Price |
$99.00 |
| Name |
IL27 Peptide - C-terminal region (AAP60748) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
IL27 |
| Alias symbols |
IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A |
| Gene id |
246778 |
| Description of target |
The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). |
| Swissprot id |
Q8NEV9 |
| Protein accession num |
NP_663634 |
| Nucleotide accession num |
NM_145659 |
| Protein size |
243 amino acids |
| Molecular weight |
27kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ |
| Partner proteins |
IL27RA |
| Subunit |
alpha |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-IL27 Antibody (ARP60748_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
