| Sku |
AAP60588 |
| Old sku |
AAPP46628 |
| Price |
$99.00 |
| Name |
MRO Peptide - C-terminal region (AAP60588) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MRO |
| Alias symbols |
B29, C18orf3, FLJ30140 |
| Gene id |
83876 |
| Description of target |
This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. |
| Swissprot id |
E9PAT5 |
| Protein accession num |
NP_001120648 |
| Nucleotide accession num |
NM_001127176 |
| Protein size |
262 amino acids |
| Molecular weight |
30kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MRO Antibody (ARP60588_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
