Sku |
AAP60369 |
Old sku |
AAPP46548 |
Price |
$99.00 |
Name |
SPRED2 Peptide - C-terminal region (AAP60369) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SPRED2 |
Alias symbols |
FLJ21897, FLJ31917, MGC163164, Spred-2 |
Gene id |
200734 |
Description of target |
SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade . |
Swissprot id |
Q7Z698 |
Protein accession num |
NP_861449 |
Nucleotide accession num |
NM_181784 |
Protein size |
418 amino acids |
Molecular weight |
47kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |
Partner proteins |
KIT,RHOA,TESK1,UBC |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SPRED2 Antibody (ARP60369_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |