SPRED2 Peptide - C-terminal region (AAP60369)

Data Sheet
 
Sku AAP60369
Old sku AAPP46548
Price $99.00
Name SPRED2 Peptide - C-terminal region (AAP60369)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SPRED2
Alias symbols FLJ21897, FLJ31917, MGC163164, Spred-2
Gene id 200734
Description of target SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade .
Swissprot id Q7Z698
Protein accession num NP_861449
Nucleotide accession num NM_181784
Protein size 418 amino acids
Molecular weight 47kDa
Species reactivity Human
Application WB
Peptide sequence NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS
Partner proteins KIT,RHOA,TESK1,UBC
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SPRED2 Antibody (ARP60369_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com