| Sku |
AAP60298 |
| Old sku |
AAPP46479 |
| Price |
$99.00 |
| Name |
LYZ Peptide - N-terminal region (AAP60298) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
LYZ |
| Alias symbols |
LZM, lysozyme |
| Gene id |
4069 |
| Description of target |
LYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis. |
| Swissprot id |
P61626 |
| Protein accession num |
NP_000230 |
| Nucleotide accession num |
NM_000239 |
| Protein size |
148 amino acids |
| Molecular weight |
15kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL |
| Partner proteins |
A2M,ELN,LCN1,LTF,KHK,LRRK1,LTF,NME2,PARP11,USP1,USP25 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-LYZ Antibody (ARP60298_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
