Sku |
AAP60116 |
Old sku |
AAPP46256 |
Price |
$99.00 |
Name |
CTSC Peptide - middle region (AAP60116) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CTSC |
Alias symbols |
CPPI, DPP1, DPPI, HMS, JP, JPD, PALS, PLS, DPP-I |
Gene id |
1075 |
Description of target |
CTSC is a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in CTSC have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. |
Swissprot id |
P53634 |
Protein accession num |
NP_001805 |
Nucleotide accession num |
NM_001814 |
Protein size |
463 amino acids |
Molecular weight |
8kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS |
Partner proteins |
CAPN1,CAPN1,CTSC,CTSL1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CTSC Antibody (ARP60116_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |