| Sku |
AAP60104 |
| Old sku |
AAPP46362 |
| Price |
$99.00 |
| Name |
CALB1 Peptide - C-terminal region (AAP60104) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CALB1 |
| Alias symbols |
CALB |
| Gene id |
793 |
| Description of target |
Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. |
| Swissprot id |
P05937 |
| Protein accession num |
NP_004920 |
| Nucleotide accession num |
NM_004929 |
| Protein size |
261 amino acids |
| Molecular weight |
30kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM |
| Partner proteins |
IMPA1,RANBP9,TRPV5,TRPV6,IKBKG,IMPA1,RANBP9 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CALB1 Antibody (ARP60104_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
