Sku |
AAP59999 |
Old sku |
AAPP46153 |
Price |
$99.00 |
Name |
COL1A1 Peptide - C-terminal region (AAP59999) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
COL1A1 |
Alias symbols |
OI4 |
Gene id |
1277 |
Description of target |
This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. |
Swissprot id |
P02452 |
Protein accession num |
NP_000079 |
Nucleotide accession num |
NM_000088 |
Protein size |
372 amino acids |
Molecular weight |
41kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG |
Partner proteins |
APPBP2,CLCF1,CNTF,CRLF1,IL6ST,KRTAP4-12,LIFR,PLSCR1,APPBP2,CLCF1,CNTF,IL6ST,KRTAP4-12,LIFR,PLSCR1 |
Subunit |
alpha |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-COL1A1 Antibody (ARP59999_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |