| Sku |
AAP59956 |
| Old sku |
AAPP46118 |
| Price |
$99.00 |
| Name |
ADORA3 Peptide - C-terminal region (AAP59956) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ADORA3 |
| Alias symbols |
A3AR, AD026, bA552M11.5, RP11-552M11.7 |
| Gene id |
140 |
| Description of target |
The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate a diverse set of physiologic functions. The type A1 receptors inhibit adenylyl cyclase, and play a role in the fertilization process. Animal studies also suggest a role for A1 receptors in kidney function and ethanol intoxication. Transcript variants with alternative splicing in the 5' UTR have been found for this gene. |
| Swissprot id |
Q5QNY7 |
| Protein accession num |
NP_001075445 |
| Nucleotide accession num |
NM_001081976 |
| Protein size |
326 amino acids |
| Molecular weight |
36kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL |
| Partner proteins |
ADA,DRD1,EPB41L2,GNAI2,GNAO1,GNAS,GNAZ,GRM1,P2RY1,ADA,DRD1,GNAI2,GRM1,P2RY1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ADORA3 Antibody (ARP59956_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
