Sku |
AAP59953 |
Old sku |
AAPP46115 |
Price |
$99.00 |
Name |
ADORA2A Peptide - C-terminal region (AAP59953) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
ADORA2A |
Alias symbols |
ADORA2, RDC8, hA2aR |
Gene id |
135 |
Description of target |
ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. |
Swissprot id |
P29274 |
Protein accession num |
NP_000666 |
Nucleotide accession num |
NM_000675 |
Protein size |
412 amino acids |
Molecular weight |
45kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP |
Partner proteins |
ACTN1,ACTN2,ACTN3,ACTN4,ADA,ADORA2A,CYTH2,DRD2,ADA,ADORA2A,DRD2 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-ADORA2A Antibody (ARP59953_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |