| Sku |
AAP59627 |
| Old sku |
AAPP45736 |
| Price |
$99.00 |
| Name |
TAAR5 Peptide - middle region (AAP59627) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TAAR5 |
| Alias symbols |
MGC138414, MGC138416, PNR, RP11-295F4.5 |
| Gene id |
9038 |
| Description of target |
TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters. |
| Swissprot id |
Q5QD28 |
| Protein accession num |
NP_003958 |
| Nucleotide accession num |
NM_003967 |
| Protein size |
337 amino acids |
| Molecular weight |
38kDa |
| Species reactivity |
Human |
| Application |
IF, WB |
| Peptide sequence |
GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TAAR5 Antibody(ARP59627_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
