Sku |
AAP59626 |
Old sku |
AAPP45735 |
Price |
$99.00 |
Name |
TAAR5 Peptide - C-terminal region (AAP59626) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
TAAR5 |
Alias symbols |
MGC138414, MGC138416, PNR, RP11-295F4.5 |
Gene id |
9038 |
Description of target |
TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters. |
Swissprot id |
O14804 |
Protein accession num |
NP_003958 |
Nucleotide accession num |
NM_003967 |
Protein size |
337 amino acids |
Molecular weight |
38kDa |
Species reactivity |
Human |
Application |
IF, WB |
Peptide sequence |
TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-TAAR5 Antibody (ARP59626_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |