Rph3a Peptide - N-terminal region (AAP59498)

Data Sheet
 
Sku AAP59498
Old sku AAPP45595
Price $99.00
Name Rph3a Peptide - N-terminal region (AAP59498)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Rph3a
Alias symbols 2900002P20Rik, AU022689, AW108370
Gene id 19894
Description of target RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Swissprot id P47708
Protein accession num NP_035416
Nucleotide accession num NM_011286
Protein size 681 amino acids
Molecular weight 75kDa
Species reactivity Mouse
Application WB
Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR
Partner proteins Rab27a,Rab27b,Rab3a,Rab3a,Rab3b,Rab3c,Rab3d,Rab8a
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Rph3a Antibody(ARP59498_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com