Sku |
AAP59498 |
Old sku |
AAPP45595 |
Price |
$99.00 |
Name |
Rph3a Peptide - N-terminal region (AAP59498) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Rph3a |
Alias symbols |
2900002P20Rik, AU022689, AW108370 |
Gene id |
19894 |
Description of target |
RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal. |
Swissprot id |
P47708 |
Protein accession num |
NP_035416 |
Nucleotide accession num |
NM_011286 |
Protein size |
681 amino acids |
Molecular weight |
75kDa |
Species reactivity |
Mouse |
Application |
WB |
Peptide sequence |
GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR |
Partner proteins |
Rab27a,Rab27b,Rab3a,Rab3a,Rab3b,Rab3c,Rab3d,Rab8a |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Rph3a Antibody(ARP59498_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |