| Sku |
AAP59340 |
| Old sku |
AAPP45438 |
| Price |
$99.00 |
| Name |
USP9X Peptide - C-terminal region (AAP59340) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
USP9X |
| Alias symbols |
DFFRX, FAF, FAM |
| Gene id |
8239 |
| Description of target |
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Swissprot id |
Q93008 |
| Protein accession num |
NP_001034679 |
| Nucleotide accession num |
NM_001039590 |
| Protein size |
2570 amino acids |
| Molecular weight |
292kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ |
| Partner proteins |
CTNNB1,DCX,MLLT4,BIRC5,CASP4,CDH1,CTNNB1,ITCH,MARK4,MLLT4,NEK6,NUAK1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-USP9X Antibody, made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
