Sku |
AAP59309 |
Old sku |
AAPP45294 |
Price |
$99.00 |
Name |
USP15 Peptide - C-terminal region (AAP59309) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
USP15 |
Alias symbols |
KIAA0529, MGC131982, MGC149838, MGC74854, UNPH4, UNPH-2 |
Gene id |
9958 |
Description of target |
Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478). |
Swissprot id |
Q9Y4E8 |
Protein accession num |
NP_006304 |
Nucleotide accession num |
NM_006313 |
Protein size |
952 amino acids |
Molecular weight |
109kDa |
Species reactivity |
Human |
Application |
IF, WB |
Peptide sequence |
GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED |
Partner proteins |
PRKD1,ADSL,ALDOA,CALML3,CD40,CKB,CSTF1,DFFA,FABP4,KRT31,KRT33B,KRT34,KRT35,KRT81,KRT85,LGALS7,LRRC15,LSM2,LSM4,LSM6,MEPCE,MYH2,MYH4,NAA38,PGAM2,PHB2,PPIH,PRPF3,PRPF31,PRPF4,PSMD11,PSMD7,RNF40,SART3,SELENBP1,TUT1,UBC,UBE2G2,USP11,VSIG8 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-USP15 Antibody(ARP59309_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |