| Sku |
AAP59265 |
| Old sku |
AAPP45252 |
| Price |
$99.00 |
| Name |
CDH1 Peptide - middle region (AAP59265) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CDH1 |
| Alias symbols |
Arc-1, CD324, CDHE, ECAD, LCAM, UVO |
| Gene id |
999 |
| Description of target |
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7. |
| Swissprot id |
P12830 |
| Protein accession num |
NP_004351 |
| Nucleotide accession num |
NM_004360 |
| Protein size |
882 amino acids |
| Molecular weight |
80kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
FSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTS |
| Partner proteins |
ZEB1,CAV1,CTNNB1,CTNNB1,CTNNB1,CTNND1,EGFR,ACTR3,ANAPC7,ARHGAP32,ARVCF,CA9,CASP3,CASP8,CBLL1,CDH1,CSE1L,CSNK2A1,CTNNA1,CTNNB1,CTNND1,CTNND2,EGFR,ERBB2IP,EZR,GNA12,GNA13,GSK3B,HDAC1,HDAC2,IQGAP1,IRS1,ITGAE,ITGB7,JUP,NDRG1,NEDD9,PKD1,PPP1CA,PSEN1,PTPN14,PTP |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CDH1 Antibody(ARP59265_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
