Sku |
AAP59241 |
Old sku |
AAPP45230 |
Price |
$99.00 |
Name |
SERPINA4 Peptide - middle region (AAP59241) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SERPINA4 |
Alias symbols |
KAL, KLST, KST, PI4, kallistatin, PI-4 |
Gene id |
5267 |
Description of target |
SERPINA4 inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein. |
Swissprot id |
P29622 |
Protein accession num |
NP_006206 |
Nucleotide accession num |
NM_006215 |
Protein size |
427 amino acids |
Molecular weight |
48kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK |
Partner proteins |
CTSD,KLK1,KLK2,KLK1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SERPINA4 Antibody(ARP59241_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |