SERPINA4 Peptide - middle region (AAP59241)

Data Sheet
 
Sku AAP59241
Old sku AAPP45230
Price $99.00
Name SERPINA4 Peptide - middle region (AAP59241)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SERPINA4
Alias symbols KAL, KLST, KST, PI4, kallistatin, PI-4
Gene id 5267
Description of target SERPINA4 inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
Swissprot id P29622
Protein accession num NP_006206
Nucleotide accession num NM_006215
Protein size 427 amino acids
Molecular weight 48kDa
Species reactivity Human
Application WB
Peptide sequence KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK
Partner proteins CTSD,KLK1,KLK2,KLK1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SERPINA4 Antibody(ARP59241_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com