| Sku |
AAP59180 |
| Old sku |
AAPP45148 |
| Price |
$99.00 |
| Name |
TIMP2 Peptide - N-terminal region (AAP59180) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TIMP2 |
| Alias symbols |
CSC-21K, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2 |
| Gene id |
7077 |
| Description of target |
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. |
| Swissprot id |
P16035 |
| Protein accession num |
NP_003246 |
| Nucleotide accession num |
NM_003255 |
| Protein size |
220 amino acids |
| Molecular weight |
22kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
NADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFI |
| Partner proteins |
ITGA3,ITGA3,ITGB1,MMP14,MMP2,MMP8,MMP14,MMP2,PSMA7,SNCG |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TIMP2 Antibody(ARP59180_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
