| Sku |
AAP59145 |
| Old sku |
AAPP45338 |
| Price |
$99.00 |
| Name |
NFATC1 Peptide - N-terminal region (AAP59145) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NFATC1 |
| Alias symbols |
MGC138448, NF-ATC, NFAT2, NFATc |
| Gene id |
4772 |
| Description of target |
NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes. |
| Swissprot id |
O95644 |
| Protein accession num |
NP_765976 |
| Nucleotide accession num |
NM_172388 |
| Protein size |
353 amino acids |
| Molecular weight |
38kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
HVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGL |
| Partner proteins |
EP300,GNB2L1,MAPK14,PIM1,PPP3R1,PRKCA,SPI1,EGR1,EGR2,HDAC3,PIM1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NFATC1 Antibody, made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
