Sku |
AAP59093 |
Old sku |
AAPP45081 |
Price |
$99.00 |
Name |
CD27 Peptide - C-terminal region (AAP59093) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CD27 |
Alias symbols |
MGC20393, S152, T14, TNFRSF7, Tp55 |
Gene id |
939 |
Description of target |
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. |
Swissprot id |
P26842 |
Protein accession num |
NP_001233 |
Nucleotide accession num |
NM_001242 |
Protein size |
260 amino acids |
Molecular weight |
27kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP |
Partner proteins |
CD70,SIVA1,TRAF2,TRAF3,TRAF5,CD5,SIVA1,TRAF1,TRAF2,TRAF3,TRAF5 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CD27 Antibody(ARP59093_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |