| Sku |
AAP58987 |
| Old sku |
AAPP44954 |
| Price |
$99.00 |
| Name |
CASP3 Peptide - C-terminal region (AAP58987) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CASP3 |
| Alias symbols |
CPP32, CPP32B, SCA-1 |
| Gene id |
836 |
| Description of target |
CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. |
| Swissprot id |
P42574 |
| Protein accession num |
NP_116786 |
| Nucleotide accession num |
NM_032991 |
| Protein size |
277 amino acids |
| Molecular weight |
12kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG |
| Partner proteins |
AR,ATN1,ATXN3,BIRC3,BIRC6,HTT,NDUFS1,NEO1,PARP1,PLEKHO1,XIAP,BIRC6,CFLAR,PSEN1,RB1,XIAP,ACIN1,ADD1,AIFM1,AKAP8,AKT1,APAF1,APP,AR,ARHGDIB,ATN1,BCAP31,BCAR1,BCL2,BID,BIRC2,BIRC3,BIRC5,BIRC6,BIRC7,BLM,BMX,BRCA1,CAD,CASP10,CASP3,CASP4,CASP6,CASP8,CASP9,CAST,C |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CASP3 Antibody(ARP58987_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
