CASP1 Peptide - middle region (AAP58983)

Data Sheet
 
Sku AAP58983
Old sku AAPP44950
Price $99.00
Name CASP1 Peptide - middle region (AAP58983)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CASP1
Alias symbols ICE, IL1BC, P45
Gene id 834
Description of target This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.
Swissprot id P29466
Protein accession num NP_001214
Nucleotide accession num NM_001223
Protein size 383 amino acids
Molecular weight 10kDa
Species reactivity Human
Application WB
Peptide sequence LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Partner proteins AR,ATN1,ATXN3,HTT,PSEN1,AR,ATN1,ATXN3,BCAP31,BCL2L1,BID,CARD16,CARD17,CARD8,CASP1,CASP14,CAST,CDK11A,CDK11B,EGFR,HTT,IL18,IL1B,LMNA,MAPT,NEDD4,NFE2L2,NLRC4,NLRP1,NOD1,PAK1,PARK2,PARP1,PLA2G4A,PSEN1,PSEN2,PYCARD,RIPK2,TFAP2A,BCAP31,CARD8,CASP1,CASP10,CASP1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CASP1 Antibody(ARP58983_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com