Sku |
AAP58983 |
Old sku |
AAPP44950 |
Price |
$99.00 |
Name |
CASP1 Peptide - middle region (AAP58983) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CASP1 |
Alias symbols |
ICE, IL1BC, P45 |
Gene id |
834 |
Description of target |
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms. |
Swissprot id |
P29466 |
Protein accession num |
NP_001214 |
Nucleotide accession num |
NM_001223 |
Protein size |
383 amino acids |
Molecular weight |
10kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE |
Partner proteins |
AR,ATN1,ATXN3,HTT,PSEN1,AR,ATN1,ATXN3,BCAP31,BCL2L1,BID,CARD16,CARD17,CARD8,CASP1,CASP14,CAST,CDK11A,CDK11B,EGFR,HTT,IL18,IL1B,LMNA,MAPT,NEDD4,NFE2L2,NLRC4,NLRP1,NOD1,PAK1,PARK2,PARP1,PLA2G4A,PSEN1,PSEN2,PYCARD,RIPK2,TFAP2A,BCAP31,CARD8,CASP1,CASP10,CASP1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CASP1 Antibody(ARP58983_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |