Sku |
AAP58975 |
Old sku |
AAPP44942 |
Price |
$99.00 |
Name |
VEGFB Peptide - middle region (AAP58975) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
VEGFB |
Alias symbols |
VEGFL, VRF |
Gene id |
7423 |
Description of target |
Vascular endothelial growth factor B (VEGFB) signals via the endothelial receptor VEGFR1 (MIM 165070) and is a regulator of blood vessel physiology, with a role in endothelial targeting of lipids to peripheral tissues (summarized by Hagberg et al., 2010 [PubMed 20228789]). |
Swissprot id |
P49765 |
Protein accession num |
NP_003368 |
Nucleotide accession num |
NM_003377 |
Protein size |
207 amino acids |
Molecular weight |
21kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT |
Partner proteins |
FLT1,NRP1,TNXB,VEGFA,VEGFB,FLT1,NRP1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-VEGFB Antibody(ARP58975_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |