| Sku |
AAP58968 |
| Old sku |
AAPP45304 |
| Price |
$99.00 |
| Name |
UCHL1 Peptide - C-terminal region (AAP58968) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
UCHL1 |
| Alias symbols |
PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5 |
| Gene id |
7345 |
| Description of target |
The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease. |
| Swissprot id |
P09936 |
| Protein accession num |
NP_004172 |
| Nucleotide accession num |
NM_004181 |
| Protein size |
223 amino acids |
| Molecular weight |
25kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC |
| Partner proteins |
CBX1,CDKN1B,COPS5,HSP90AA1,HSPA8,LAMP2,NEDD8,RANBP9,UBB,UBE2I,CBX1,CCDC14,CDKN1B,COPS5,EGFR,KRT17,KRT4,NEDD8,RANBP9,TP53,UBC,UBE2I,USP21 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-UCHL1 Antibody(ARP58968_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
