| Sku |
AAP58959 |
| Old sku |
AAPP44930 |
| Price |
$99.00 |
| Name |
STK11 Peptide - C-terminal region (AAP58959) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
STK11 |
| Alias symbols |
LKB1, PJS, hLKB1 |
| Gene id |
6794 |
| Description of target |
STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. |
| Swissprot id |
Q15831 |
| Protein accession num |
NP_000446 |
| Nucleotide accession num |
NM_000455 |
| Protein size |
433 amino acids |
| Molecular weight |
49kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDF |
| Partner proteins |
MARK4,PRKAA2,STK11,STRADB,ATM,CAB39,CDC37,MARK1,MARK2,MARK4,MOBKL3,PARD3,PRKAA2,PRKACA,PTEN,RPS6KA3,RPS6KA5,RPS6KB1,SMARCA4,SNRK,STK11,STK11IP,STRADA,STRADB,TNIP2,TP53,CAB39,CAB39L,CDC37,FKBP5,HSP90AA1,SMARCA4,STK11IP,STRADA,STRADB,TP53,WDR48 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-STK11 Antibody(ARP58959_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
