| Sku |
AAP58951 |
| Old sku |
AAPP44923 |
| Price |
$99.00 |
| Name |
SNAG1 Peptide - middle region (AAP58951) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SNX18 |
| Alias symbols |
FLJ11997, FLJ32560, FLJ61062, MGC150827, MGC150829, SH3PX2, SH3PXD3B, SNAG1 |
| Gene id |
112574 |
| Description of target |
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
Q96RF0-2 |
| Protein accession num |
NP_001096045 |
| Nucleotide accession num |
NM_001102575 |
| Protein size |
624 amino acids |
| Molecular weight |
69kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
QCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD |
| Partner proteins |
ANKRD28; GRB2; CBL; CUL1; FASLG; UBC; ITCH; SOS2; SOS1; |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SNAG1 Antibody(ARP58951_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
