| Sku |
AAP58905 |
| Old sku |
AAPP44852 |
| Price |
$99.00 |
| Name |
GNAI3 Peptide - N-terminal region (AAP58905) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
GNAI3 |
| Alias symbols |
87U6, FLJ26559 |
| Gene id |
2773 |
| Description of target |
GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels. |
| Swissprot id |
P08754 |
| Protein accession num |
NP_006487 |
| Nucleotide accession num |
NM_006496 |
| Protein size |
354 amino acids |
| Molecular weight |
39kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK |
| Partner proteins |
AGTR2,CCR5,CD48,CD59,CNR1,CXCR2,DRD2,GNAI3,GPSM2,HTR1A,LPAR1,MTNR1A,MTNR1B,NGB,NUCB1,PTPRU,RGS10,RGS12,RGS14,RGS16,RGS18,RGS19,RGS20,RGS3,RGS5,RGS7,RIC8A,S1PR1,TSHR,C5AR1,CNR1,GPSM2,MTNR1A,Nucb1,RGS10,RGS12,RGS14,RGS16,RGS18,RGS19,RGS2,RGS3,RGS5,RGS7,RIC8 |
| Subunit |
alpha |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-GNAI3 Antibody(ARP58905_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
