SPACA4 Peptide - N-terminal region (AAP58662)

Data Sheet
 
Sku AAP58662
Price $99.00
Name SPACA4 Peptide - N-terminal region (AAP58662)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SPACA4
Alias symbols SAMP14
Gene id 171169
Description of target SPACA4 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
Swissprot id Q8TDM5
Protein accession num NP_598005
Nucleotide accession num NM_133498
Protein size 124 amino acids
Molecular weight 14kDa
Species reactivity Human
Application WB
Peptide sequence MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SPACA4 Antibody (ARP58662_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com