| Sku |
AAP57828 |
| Old sku |
AAPP43102 |
| Price |
$99.00 |
| Name |
PRKACA Peptide - N-terminal region (AAP57828) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
PRKACA |
| Alias symbols |
MGC102831, MGC48865, PKACA |
| Gene id |
5566 |
| Description of target |
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Swissprot id |
A8K8B9 |
| Protein accession num |
NP_997401 |
| Nucleotide accession num |
NM_207518 |
| Protein size |
343 amino acids |
| Molecular weight |
40kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
| Partner proteins |
NMT1,AANAT,ABCA1,ACCN2,ACLY,ADCY5,ADD1,ADD2,ADRBK1,AKAP14,AKAP8L,APC,ATF1,ATP2B1,AURKA,BAD,BCL2,BRAF,C11orf17,C7orf16,CACNA1C,CACNB2,CACNG2,CAD,CCND1,CDK16,CETN1,CFTR,CIITA,CLDN3,CREM,CSK,CUL5,DNAJC5,DSP,EEF2K,EGFR,EPB49,ESR1,ETV1,FOS,FXYD1,GABRR1,GFAP,GJ |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-PRKACA Antibody(ARP57828_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
