| Sku |
AAP57549 |
| Old sku |
AAPP43035 |
| Price |
$99.00 |
| Name |
GNB4 Peptide - middle region (AAP57549) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
GNB4 |
| Gene id |
59345 |
| Description of target |
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. |
| Swissprot id |
Q9HAV0 |
| Protein accession num |
NP_067642 |
| Nucleotide accession num |
NM_021629 |
| Protein size |
340 amino acids |
| Molecular weight |
37kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY |
| Partner proteins |
GNG12,GNG13,GNG4,MTNR1A,MTNR1B,GNG13,GNG3,GNG4,GNG5,GNG7,GNGT2,git11 |
| Subunit |
beta-4 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-GNB4 Antibody(ARP57549_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
