Dennd1a Peptide - C-terminal region (AAP57502)

Data Sheet
 
Sku AAP57502
Price $99.00
Name Dennd1a Peptide - C-terminal region (AAP57502)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Dennd1a
Alias symbols 6030446I19Rik, MGC38995, connecdenn
Gene id 227801
Description of target Dennd1a is a guanine nucleotide exchange factor (GEF) for RAB35. It may be involved in the clathrin-mediated endocytosis of synaptic vesicles.
Swissprot id Q8K382
Protein accession num NP_666234
Nucleotide accession num NM_146122
Protein size 1016 amino acids
Molecular weight 111kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Dennd1a Antibody (ARP57502_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com