| Sku |
AAP57420 |
| Old sku |
AAPP41419 |
| Price |
$99.00 |
| Name |
ACTR3B Peptide - N-terminal region (AAP57420) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ACTR3B |
| Alias symbols |
ARP11, ARP3BETA, DKFZp686O24114 |
| Gene id |
57180 |
| Description of target |
ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors. |
| Swissprot id |
Q9P1U1 |
| Protein accession num |
NP_065178 |
| Nucleotide accession num |
NM_020445 |
| Protein size |
418 amino acids |
| Molecular weight |
47kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR |
| Partner proteins |
RSRC1,ACTR2,ARPC1A,ARPC1B,ARPC2,ARPC3,ARPC3P1,ARPC4,ARPC5,ARPC5L,CDK4,KIAA1967,TWF2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ACTR3B Antibody(ARP57420_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
