Sku |
AAP57355 |
Old sku |
AAPP41234 |
Price |
$99.00 |
Name |
UBQLN4 Peptide - middle region (AAP57355) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
UBQLN4 |
Alias symbols |
A1U, C1orf6, UBIN, CIP75 |
Gene id |
56893 |
Description of target |
The function of this protein remains unknown. |
Swissprot id |
Q9NRR5 |
Protein accession num |
NP_064516 |
Nucleotide accession num |
NM_020131 |
Protein size |
601 amino acids |
Molecular weight |
64kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS |
Partner proteins |
ADAM33,ADPGK,AGR2,ANKRD13D,AREG,ARL4C,ATPIF1,ATXN1,BAG6,C11orf49,C19orf10,C1QTNF1,C1orf94,CACNA1G,CCDC107,CCDC134,CCDC136,CCDC14,CCDC33,CCL21,CD99,CDSN,CEND1,COL8A1,COPB1,CPSF6,CRIPT,CSTF2,CSTF2T,CYB5R1,DAZAP2,DKK3,DMPK,DTX2,EAPP,EDN1,EEF1A1,EFEMP2,ELF5,E |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-UBQLN4 Antibody(ARP57355_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |