| Sku |
AAP57355 |
| Old sku |
AAPP41234 |
| Price |
$99.00 |
| Name |
UBQLN4 Peptide - middle region (AAP57355) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
UBQLN4 |
| Alias symbols |
A1U, C1orf6, UBIN, CIP75 |
| Gene id |
56893 |
| Description of target |
The function of this protein remains unknown. |
| Swissprot id |
Q9NRR5 |
| Protein accession num |
NP_064516 |
| Nucleotide accession num |
NM_020131 |
| Protein size |
601 amino acids |
| Molecular weight |
64kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS |
| Partner proteins |
ADAM33,ADPGK,AGR2,ANKRD13D,AREG,ARL4C,ATPIF1,ATXN1,BAG6,C11orf49,C19orf10,C1QTNF1,C1orf94,CACNA1G,CCDC107,CCDC134,CCDC136,CCDC14,CCDC33,CCL21,CD99,CDSN,CEND1,COL8A1,COPB1,CPSF6,CRIPT,CSTF2,CSTF2T,CYB5R1,DAZAP2,DKK3,DMPK,DTX2,EAPP,EDN1,EEF1A1,EFEMP2,ELF5,E |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-UBQLN4 Antibody(ARP57355_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
