| Sku |
AAP57352 |
| Old sku |
AAPP41231 |
| Price |
$99.00 |
| Name |
CYP26B1 Peptide - middle region (AAP57352) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CYP26B1 |
| Alias symbols |
CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2 |
| Gene id |
56603 |
| Description of target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid. |
| Swissprot id |
Q9NR63 |
| Protein accession num |
NP_063938 |
| Nucleotide accession num |
NM_019885 |
| Protein size |
512 amino acids |
| Molecular weight |
57kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CYP26B1 Antibody(ARP57352_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
