Sku |
AAP57258 |
Old sku |
AAPP44233 |
Price |
$99.00 |
Name |
CENPN Peptide - middle region (AAP57258) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CENPN |
Alias symbols |
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660 |
Gene id |
55839 |
Description of target |
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]). |
Protein accession num |
NP_001094095 |
Nucleotide accession num |
NM_001100625 |
Protein size |
353 amino acids |
Molecular weight |
41kDa |
Species reactivity |
Human |
Application |
IF, WB |
Peptide sequence |
SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CENPN Antibody(ARP57258_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |