| Sku |
AAP55304 |
| Old sku |
AAPP33135 |
| Price |
$99.00 |
| Name |
C1orf144 Peptide - N-terminal region (AAP55304) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SZRD1 |
| Alias symbols |
DKFZp566C0424, MGC70432, C1orf144 |
| Gene id |
26099 |
| Description of target |
The function of this protein remains unknown. |
| Swissprot id |
Q7Z422-4 |
| Protein accession num |
NP_056424 |
| Nucleotide accession num |
NM_015609 |
| Protein size |
133 amino acids |
| Molecular weight |
15kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN |
| Partner proteins |
UBC; P3H1; EHD4; NT5C2; MTMR2; ZPR1; SRP14; SRP9; ELAVL1; |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-C1orf144 Antibody (ARP55304_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
