| Sku |
AAP54796 |
| Price |
$99.00 |
| Name |
Dnajb1 Peptide - C-terminal region (AAP54796) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Dnajb1 |
| Alias symbols |
0610007I11Rik, HSPF1, Hsp40 |
| Gene id |
81489 |
| Description of target |
Dnajb1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP. |
| Swissprot id |
Q9QYJ3 |
| Protein accession num |
NP_061278 |
| Nucleotide accession num |
NM_018808 |
| Protein size |
340 amino acids |
| Molecular weight |
37kDa |
| Species reactivity |
Mouse, Human |
| Application |
WB |
| Peptide sequence |
VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Dnajb1 Antibody (ARP54796_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
