| Sku |
AAP54663 |
| Old sku |
AAPP44525 |
| Price |
$99.00 |
| Name |
INHBA Peptide - N-terminal region (AAP54663) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
INHBA |
| Alias symbols |
EDF, FRP |
| Gene id |
3624 |
| Description of target |
The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome. |
| Swissprot id |
P08476 |
| Protein accession num |
NP_002183 |
| Nucleotide accession num |
NM_002192 |
| Protein size |
426 amino acids |
| Molecular weight |
44kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL |
| Partner proteins |
INHBA,ACVR1,ACVR1B,ACVR2A,ACVR2B,CHRDL2,ENG,FST,FSTL3,IGFBP7,INHA,INHBA,INHBB,INHBC,TGFBR3,ACVR1B,ACVR2A,ACVR2B,CHRDL2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-INHBA Antibody(ARP54663_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
