| Sku |
AAP54523 |
| Old sku |
AAPP41704 |
| Price |
$99.00 |
| Name |
FGR Peptide - middle region (AAP54523) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
FGR |
| Alias symbols |
FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr, p55-Fgr, p58-Fgr |
| Gene id |
2268 |
| Description of target |
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Swissprot id |
P09769 |
| Protein accession num |
NP_001036194 |
| Nucleotide accession num |
NM_001042729 |
| Protein size |
529 amino acids |
| Molecular weight |
59kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ |
| Partner proteins |
ARRB1,CBL,CCR3,CD24,CSK,DAB2,DOK1,FGR,HCLS1,INPP5D,PTK2,SLAMF1,SNCA,SRC,SYK,VDR,WAS,YWHAQ,CBL,CCR3,CD24,DAB2,DOK1,FASLG,HCLS1,IKBKG,NCOA6,PTK2,SLAMF1,SYK,WAS |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-FGR Antibody(ARP54523_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
