| Sku |
AAP54445 |
| Price |
$99.00 |
| Name |
PGBD2 Peptide - middle region (AAP54445) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
PGBD2 |
| Gene id |
267002 |
| Description of target |
The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. |
| Swissprot id |
Q6P3X8-2 |
| Protein accession num |
NP_001017434 |
| Nucleotide accession num |
NM_001017434 |
| Protein size |
341 amino acids |
| Molecular weight |
39kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-PGBD2 Antibody (ARP54445_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
