| Sku |
AAP54323 |
| Old sku |
AAPP43207 |
| Price |
$99.00 |
| Name |
IL1B Peptide - N-terminal region (AAP54323) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
IL1B |
| Alias symbols |
IL-1, IL1-BETA, IL1F2 |
| Gene id |
3553 |
| Description of target |
IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
| Swissprot id |
P01584 |
| Protein accession num |
NP_000567 |
| Nucleotide accession num |
NM_000576 |
| Protein size |
269 amino acids |
| Molecular weight |
17kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL |
| Partner proteins |
A2M,ADRB2,CASP1,CASP4,IL1B,IL1R1,IL1R2,IL1RAP,MMP2,PRTN3,IL1R1,MAPK8IP2,UBE2N,ZNF675 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-IL1B Antibody(ARP54323_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
