Sku |
AAP53837 |
Old sku |
AAPP45612 |
Price |
$99.00 |
Name |
GTF2A1L Peptide - C-terminal region (AAP53837) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
GTF2A1L |
Alias symbols |
ALF, MGC26254 |
Gene id |
11036 |
Description of target |
The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. |
Protein accession num |
NP_751946 |
Nucleotide accession num |
NM_172196 |
Protein size |
453 amino acids |
Molecular weight |
49kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD |
Partner proteins |
ASCL3,CSNK2A1,CSNK2A2,GTF2A2,ID3,SUB1,ATF4,CEBPE,EMX1,EMX2,HMG20A,HOXA5,HOXC11,HOXC9,MAFF,MAFG,NKX2-3,PAX9,RBFOX2,SIX6,TBP,TLX2,TLX3,ZBTB3 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-GTF2A1L Antibody(ARP53837_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |