GTF2A1L Peptide - C-terminal region (AAP53837)

Data Sheet
 
Sku AAP53837
Old sku AAPP45612
Price $99.00
Name GTF2A1L Peptide - C-terminal region (AAP53837)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GTF2A1L
Alias symbols ALF, MGC26254
Gene id 11036
Description of target The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
Protein accession num NP_751946
Nucleotide accession num NM_172196
Protein size 453 amino acids
Molecular weight 49kDa
Species reactivity Human
Application WB
Peptide sequence EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
Partner proteins ASCL3,CSNK2A1,CSNK2A2,GTF2A2,ID3,SUB1,ATF4,CEBPE,EMX1,EMX2,HMG20A,HOXA5,HOXC11,HOXC9,MAFF,MAFG,NKX2-3,PAX9,RBFOX2,SIX6,TBP,TLX2,TLX3,ZBTB3
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-GTF2A1L Antibody(ARP53837_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com