| Sku |
AAP53588 |
| Price |
$99.00 |
| Name |
ADAM2 Peptide - N-terminal region (AAP53588) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ADAM2 |
| Alias symbols |
CRYN1, CRYN2, CT15, FTNB, PH-30b, PH30 |
| Gene id |
2515 |
| Description of target |
ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. |
| Swissprot id |
Q99965 |
| Protein accession num |
NP_001455 |
| Nucleotide accession num |
NM_001464 |
| Protein size |
735 amino acids |
| Molecular weight |
81kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH |
| Partner proteins |
CD9,CLGN,CLGN,CRYAB,DNM1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ADAM2 Antibody (ARP53588_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
