| Sku |
AAP53340 |
| Old sku |
AAPP42240 |
| Price |
$99.00 |
| Name |
CHMP4B Peptide - middle region (AAP53340) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CHMP4B |
| Alias symbols |
C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2 |
| Gene id |
128866 |
| Description of target |
This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts. |
| Swissprot id |
Q9H444 |
| Protein accession num |
NP_789782 |
| Nucleotide accession num |
NM_176812 |
| Protein size |
224 amino acids |
| Molecular weight |
25kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP |
| Partner proteins |
PDCD6IP,CHMP1B,CHMP4A,CHMP4B,CHMP4C,CHMP5,CHMP6,EXOSC9,HIPK2,PDCD6IP,PIAS2,STAMBP,UBE2I,VPS24,VPS4A,UBE2I |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CHMP4B Antibody(ARP53340_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
