2810405K02Rik Peptide - middle region (AAP52920)

Data Sheet
 
Sku AAP52920
Old sku AAPP34906
Price $99.00
Name 2810405K02Rik Peptide - middle region (AAP52920)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Fam213b
Alias symbols Fam213b, PM/PGFS, AI836168, RP23-15L19.6, 2810405K02Rik
Gene id 66469
Description of target 2810405K02Rik catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. It also be able to reduce prostaglandin H2 to prostaglandin F(2alpha).
Swissprot id Q9DB60
Protein accession num NP_079858
Nucleotide accession num NM_025582
Protein size 201 amino acids
Molecular weight 22kDa
Species reactivity Mouse
Application WB
Peptide sequence SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-2810405K02Rik Antibody (ARP52920_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com